Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PRKAG1 protein

This Mouse PRKAG1 protein spans the amino acid sequence from region 1-330aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AMPK gamma1 (AMPK subunit gamma-1) (AMPKg) (Prkaac)

UniProt

O54950

Expression Region

1-330aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

mmu-miR-7017-3p Primers
MPM01854 150 µL / 10 µM

mmu-miR-7017-3p Primers

Sign In for Pricing
View Details
MgMT, 1-207aa, Human, His-tag, Recombinant, E.coli
E53A02967 50 µg

MgMT, 1-207aa, Human, His-tag, Recombinant, E.coli

Sign In for Pricing
View Details
Tgif2lx2 Mouse shRNA Plasmid (Locus ID 100039551)
TR518870 1 Kit

Tgif2lx2 Mouse shRNA Plasmid (Locus ID 100039551)

Sign In for Pricing
View Details
TMEM93 AAV Vector (Rat) (CMV)
47114106 1 µg

TMEM93 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
HNRNPH2 3'UTR GFP Stable Cell Line
TU060043 1.0 mL

HNRNPH2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Lentiviral mouse Cldn3 shRNA (UAS) - Lentiviral mouse Cldn3 shRNA (UAS) plasmid
GTR15271495 1 Vial

Lentiviral mouse Cldn3 shRNA (UAS) - Lentiviral mouse Cldn3 shRNA (UAS) plasmid

Sign In for Pricing
View Details