Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse PRKAG1 protein

This Mouse PRKAG1 protein spans the amino acid sequence from region 1-330aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AMPK gamma1 (AMPK subunit gamma-1) (AMPKg) (Prkaac)

UniProt

O54950

Expression Region

1-330aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLTGGEKKP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AKT3 Protein, N-His
E55P3255 50 µg

Recombinant Human AKT3 Protein, N-His

Sign In for Pricing
View Details
ARP3 Rabbit Polyclonal Antibody (APC)
orb995854 100 µL

ARP3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
NTB-A, Fc Chimera, Recombinant, Human (SLAMF6)
MBS637813-01 0.05 mg

NTB-A, Fc Chimera, Recombinant, Human (SLAMF6)

Sign In for Pricing
View Details
NTB-A, Fc Chimera, Recombinant, Human (SLAMF6)
MBS637813-02 5x 0.05 mg

NTB-A, Fc Chimera, Recombinant, Human (SLAMF6)

Sign In for Pricing
View Details
YciC Antibody
orb831453 2 mg

YciC Antibody

Sign In for Pricing
View Details
Caprisil C4 HPLC Column, 5 µm, 300 Å, CB558-C4 x 100 mm
CB458-C4 5 µm

Caprisil C4 HPLC Column, 5 µm, 300 Å, CB558-C4 x 100 mm

Sign In for Pricing
View Details