Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria MAP_1030 protein

This Bacteria MAP_1030 protein spans the amino acid sequence from region 1-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAP_1030, Probable transcriptional regulatory protein MAP_1030

UniProt

P62039

Expression Region

1-250aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTITYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKSVVTCEKNGLTEDDILAAVLDAGAEEVEDLGDSFEIICEPTDLVAVRTALQDAGIDYDSAEAGFQPSVTVPLNADGAQKVMRLVDALEDSDDVQDVWTNADIPDEILAQIEE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CBLN1 Antibody
E11-15056C 100 µg

CBLN1 Antibody

Sign In for Pricing
View Details
Anti-Human XI collagen Antibody (L10D9)
RHK33801 100 μg

Anti-Human XI collagen Antibody (L10D9)

Sign In for Pricing
View Details
Mouse WARS siRNA
abx939633-01 15 nmol

Mouse WARS siRNA

Sign In for Pricing
View Details
Mouse WARS siRNA
abx939633-02 30 nmol

Mouse WARS siRNA

Sign In for Pricing
View Details
CD1b (MaxLight 650) discontinued
C2252-02C-ML650 100 µL

CD1b (MaxLight 650) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Nrtn shRNA (UAS) - Lentiviral mouse Nrtn shRNA (UAS) plasmid
GTR15280075 1 Vial

Lentiviral mouse Nrtn shRNA (UAS) - Lentiviral mouse Nrtn shRNA (UAS) plasmid

Sign In for Pricing
View Details