Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CDR1 protein

This Human CDR1 protein spans the amino acid sequence from region 1-262aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CDR34

UniProt

P51861

Expression Region

1-262aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAWLEDVDFLEDVPLLEDIPLLEDVPLLEDVPLLEDTSRLEDINLMEDMALLEDVDLLEDTDFLEDLDFSEAMDLREDKDFLEDMDSLEDMALLEDVDLLEDTDFLEDPDFLEAIDLREDKDFLEDMDSLEDLEAIGRCGFSGRHGFFGRRRFSGRPKLSGRLGLLGRRGFSGRLGGYWKTWIFWKTWIFWKTWIFRKTYIGWKTWIFSGRCGLTGRPGFGGRRRFFWKTLTDWKTWISFWKTLIDWKTWISFWKTLIDWKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)
MBS2106195-01 0.1 mL

APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)
MBS2106195-02 0.2 mL

APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)
MBS2106195-03 0.5 mL

APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)
MBS2106195-04 1 mL

APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)
MBS2106195-05 5 mL

APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)
MBS2106195-06 5x 5 mL

APC-Linked Monoclonal Antibody to Macrophage Inflammatory Protein 1 Alpha (MIP1a)

Sign In for Pricing
View Details