Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CSF1 protein

This Human CSF1 protein spans the amino acid sequence from region 33-190aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; Lanimostim; Proteoglycan macrophage colony-stimulating factor; Processed macrophage colony-stimulating factor 1; Macrophage colony-stimulating factor 1 43 kDa subunit; CSF1

UniProt

P09603

Expression Region

33-190aa

Tag

C-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by the dose-dependent stimulation of the proliferation of THP-1 cells is 0.5913-1.205 ng/mL.

Form

Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human AG-2 Recombinant Protein C-6 His Tag
MBS8431152-01 0.05 mg

Human AG-2 Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
Human AG-2 Recombinant Protein C-6 His Tag
MBS8431152-02 5x 0.05 mg

Human AG-2 Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
4- (2-methoxy-5-methylphenyl) tetrahydro-2H-pyran-4-ol
OR1082614-01 250 mg

4- (2-methoxy-5-methylphenyl) tetrahydro-2H-pyran-4-ol

Sign In for Pricing
View Details
4- (2-methoxy-5-methylphenyl) tetrahydro-2H-pyran-4-ol
OR1082614-02 500 mg

4- (2-methoxy-5-methylphenyl) tetrahydro-2H-pyran-4-ol

Sign In for Pricing
View Details
4- (2-methoxy-5-methylphenyl) tetrahydro-2H-pyran-4-ol
OR1082614-03 1 g

4- (2-methoxy-5-methylphenyl) tetrahydro-2H-pyran-4-ol

Sign In for Pricing
View Details
Olr810 (NM_001000975) Rat Tagged ORF Clone Lentiviral Particle
RR203686L3V 200 µL

Olr810 (NM_001000975) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details