Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf20 protein

This Mouse Fgf20 protein spans the amino acid sequence from region 1-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-20

UniProt

Q9ESL9

Expression Region

1-211aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S215 ORF Vector (Human) (pORF)
ORF029108 1.0 µg DNA

RN5S215 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
SCML4 siRNA (Mouse)
CRN3968-01 15 nmol

SCML4 siRNA (Mouse)

Sign In for Pricing
View Details
SCML4 siRNA (Mouse)
CRN3968-02 30 nmol

SCML4 siRNA (Mouse)

Sign In for Pricing
View Details
Esophagus tissue with esophagus cancer tissue array, including pathology grade, TNM and clinical stage, 80 cases/80 cores
BN02014 80 Cases / 80 Cores

Esophagus tissue with esophagus cancer tissue array, including pathology grade, TNM and clinical stage, 80 cases/80 cores

Sign In for Pricing
View Details
Indacaterol Maleate
S3083-1g 1 g

Indacaterol Maleate

Sign In for Pricing
View Details
YIF1A ORF Vector (Human) (pORF)
50609011 1.0 µg DNA

YIF1A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details