Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf20 protein

This Mouse Fgf20 protein spans the amino acid sequence from region 1-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-20

UniProt

Q9ESL9

Expression Region

1-211aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfactory receptor 4C3 Rabbit Polyclonal Antibody
E28PT3338 100 µL

Olfactory receptor 4C3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Monkey sCD44s ELISA Kit
EMKC0051 96 Tests

Monkey sCD44s ELISA Kit

Sign In for Pricing
View Details
Zfp90 3'UTR GFP Stable Cell Line
TU172906 1.0 mL

Zfp90 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human PCID2 (NM_001127202) AAV Particle
RC227374A1V 250 µL

Human PCID2 (NM_001127202) AAV Particle

Sign In for Pricing
View Details
Snx4 Mouse shRNA Plasmid (Locus ID 69150)
TR516516 1 Kit

Snx4 Mouse shRNA Plasmid (Locus ID 69150)

Sign In for Pricing
View Details
CAPN8 CRISPRa sgRNA lentivector (set of three targets)(Mouse)
15000124 3x 1.0µg DNA

CAPN8 CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details