Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Fgf20 protein

This Mouse Fgf20 protein spans the amino acid sequence from region 1-211aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FGF-20

UniProt

Q9ESL9

Expression Region

1-211aa

Tag

Tag-Free

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

23.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAPLTEVGAFLGGLEGLSQQVGSHFLLPPAGERPPLLGERRGALERGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATP5E Protein Vector (Human) (pPM-C-HA)
12712021 500 ng

ATP5E Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Batf3 Antibody, HRP conjugated
A13863-100UG 100 µg

Batf3 Antibody, HRP conjugated

Sign In for Pricing
View Details
B020004J07Rik Recombinant Protein (Mouse)
RP118430 100 µg

B020004J07Rik Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Human Family With Sequence Similarity 3, Member A (FAM3A) ELISA Kit
MBS2031842-01 24 Strip Well

Human Family With Sequence Similarity 3, Member A (FAM3A) ELISA Kit

Sign In for Pricing
View Details
Human Family With Sequence Similarity 3, Member A (FAM3A) ELISA Kit
MBS2031842-02 48 Well

Human Family With Sequence Similarity 3, Member A (FAM3A) ELISA Kit

Sign In for Pricing
View Details
Human Family With Sequence Similarity 3, Member A (FAM3A) ELISA Kit
MBS2031842-03 96 Well

Human Family With Sequence Similarity 3, Member A (FAM3A) ELISA Kit

Sign In for Pricing
View Details