Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Il11 protein

This Rat Il11 protein spans the amino acid sequence from region 22-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-11

UniProt

Q99MF5

Expression Region

22-199aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AR Blocking Peptide
MBS9620031-01 1 mg

AR Blocking Peptide

Sign In for Pricing
View Details
AR Blocking Peptide
MBS9620031-02 5x 1 mg

AR Blocking Peptide

Sign In for Pricing
View Details
PRKCD Antibody (HRP)
orb686173-01 50 μL

PRKCD Antibody (HRP)

Sign In for Pricing
View Details
PRKCD Antibody (HRP)
orb686173-02 100 µL

PRKCD Antibody (HRP)

Sign In for Pricing
View Details
BBS12 Protein Vector (Mouse) (pPB-N-His)
PV158403 500 ng

BBS12 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
ASFV F778R Protein (N-His, African swine fever virus)
P500714 100 µg

ASFV F778R Protein (N-His, African swine fever virus)

Sign In for Pricing
View Details