Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Il11 protein

This Rat Il11 protein spans the amino acid sequence from region 22-199aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IL-11

UniProt

Q99MF5

Expression Region

22-199aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPPAGSPRVSSDPRADLDSAVLLTRSLLADTRQLAAQMRDKFPADGDHNLDSLPTLAMSAGTLGSLQLPGVLTRLRVDLMSYFRHVQWLRRAAGPSLKTLEPELGALQARLERLLRRLQLLMSRLALPQAAPDQPAVPLGPPASAWGSIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

InVivoMAb Anti-Human CCL2 / MCP-1 antibody
TBS10329-5MG 5 mg

InVivoMAb Anti-Human CCL2 / MCP-1 antibody

Sign In for Pricing
View Details
VAMP2 Rabbit Polyclonal Antibody (APC-Cy7)
orb2468548 100 µL

VAMP2 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
KCNJ10 Antibody
CSB-PA012048LA01HU-01 50 µg

KCNJ10 Antibody

Sign In for Pricing
View Details
KCNJ10 Antibody
CSB-PA012048LA01HU-02 100 µg

KCNJ10 Antibody

Sign In for Pricing
View Details
CD31 (PECAM-1, Platelet gpIIa Molecule) (MaxLight 405)
MBS6244797-01 0.1 mL

CD31 (PECAM-1, Platelet gpIIa Molecule) (MaxLight 405)

Sign In for Pricing
View Details
CD31 (PECAM-1, Platelet gpIIa Molecule) (MaxLight 405)
MBS6244797-02 5x 0.1 mL

CD31 (PECAM-1, Platelet gpIIa Molecule) (MaxLight 405)

Sign In for Pricing
View Details