Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant BAM3 protein

This Plant BAM3 protein spans the amino acid sequence from region 50-548aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 8) (Chloroplast beta-amylase) (CT-BMY) (BMY8) (CTBMY)

UniProt

O23553

Expression Region

50-548aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EMKFTHEKTFTPEGETLEKWEKLHVLSYPHSKNDASVPVFVMLPLDTVTMSGHLNKPRAMNASLMALKGAGVEGVMVDAWWGLVEKDGPMNYNWEGYAELIQMVQKHGLKLQVVMSFHQCGGNVGDSCSIPLPPWVLEEISKNPDLVYTDKSGRRNPEYISLGCDSVPVLRGRTPIQVYSDFMRSFRERFEGYIGGVIAEIQVGMGPCGELRYPSYPESNGTWRFPGIGEFQCYDKYMKSSLQAYAESIGKTNWGTSGPHDAGEYKNLPEDTEFFRRDGTWNSEYGKFFMEWYSGKLLEHGDQLLSSAKGIFQGSGAKLSGKVAGIHWHYNTRSHAAELTAGYYNTRNHDGYLPIAKMFNKHGVVLNFTCMEMKDGEQPEHANCSPEGLVKQVQNATRQAGTELAGENALERYDSSAFGQVVATNRSDSGNGLTAFTYLRMNKRLFEGQNWQQLVEFVKNMKEGGHGRRLSKEDTTGSDLYVGFVKGKIAENVEEAALV

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGKV6D-21 sgRNA CRISPR Lentivector (Human) (Target 3)
K1060404 1.0 µg DNA

IGKV6D-21 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Cytidine 5'-Phosphoromorpholidate N, N'-Dicyclohexyl-4-morpholinecarboximidamide
sc-500601 100 mg

Cytidine 5'-Phosphoromorpholidate N, N'-Dicyclohexyl-4-morpholinecarboximidamide

Sign In for Pricing
View Details
Human SIGLEC6 (Sialic Acid Binding Ig Like Lectin 6) ELISA Kit
EK244620 96 Well

Human SIGLEC6 (Sialic Acid Binding Ig Like Lectin 6) ELISA Kit

Sign In for Pricing
View Details
Guinea pig advanced oxidation protein products (AOPP) ELISA Kit
CK-bio-17975-01 48 Tests

Guinea pig advanced oxidation protein products (AOPP) ELISA Kit

Sign In for Pricing
View Details
Guinea pig advanced oxidation protein products (AOPP) ELISA Kit
CK-bio-17975-02 96 Tests

Guinea pig advanced oxidation protein products (AOPP) ELISA Kit

Sign In for Pricing
View Details
Guinea pig advanced oxidation protein products (AOPP) ELISA Kit
CK-bio-17975-03 5x 96 Tests

Guinea pig advanced oxidation protein products (AOPP) ELISA Kit

Sign In for Pricing
View Details