Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A Non-structural glycoprotein 4 protein

This Virus A Non-structural glycoprotein 4 protein spans the amino acid sequence from region 52-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NCVP5 (NS28) (NSP4)

UniProt

Q9PYC8

Expression Region

52-175aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUPL2 Antibody
CSB-PA016211GA01HU 100 µL

NUPL2 Antibody

Sign In for Pricing
View Details
Daxx AAV siRNA Pooled Vector
17666164 1.0 µg

Daxx AAV siRNA Pooled Vector

Sign In for Pricing
View Details
KLRK1 Antibody
OACA10168-100UG 100 µg

KLRK1 Antibody

Sign In for Pricing
View Details
Recombinant Human ZBTB8OS Protein - (Dry Ice)
H00339487-P01-10ug 10 µg

Recombinant Human ZBTB8OS Protein - (Dry Ice)

Sign In for Pricing
View Details
Human EPM2AIP1 Matched Antibody Pair Set [ABP-Q-0595]
ABP-Q-0595 5 Plates

Human EPM2AIP1 Matched Antibody Pair Set [ABP-Q-0595]

Sign In for Pricing
View Details
GSDMD Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-14287R-BF555 100 µL

GSDMD Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details