Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A Non-structural glycoprotein 4 protein

This Virus A Non-structural glycoprotein 4 protein spans the amino acid sequence from region 52-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NCVP5 (NS28) (NSP4)

UniProt

Q9PYC8

Expression Region

52-175aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MHC Class I Polypeptide Related Sequence B (MICB) ELISA Kit
MBS457251-01 48 Tests

Human MHC Class I Polypeptide Related Sequence B (MICB) ELISA Kit

Sign In for Pricing
View Details
Human MHC Class I Polypeptide Related Sequence B (MICB) ELISA Kit
MBS457251-02 96 Tests

Human MHC Class I Polypeptide Related Sequence B (MICB) ELISA Kit

Sign In for Pricing
View Details
Human MHC Class I Polypeptide Related Sequence B (MICB) ELISA Kit
MBS457251-03 5x 96 Tests

Human MHC Class I Polypeptide Related Sequence B (MICB) ELISA Kit

Sign In for Pricing
View Details
Human MHC Class I Polypeptide Related Sequence B (MICB) ELISA Kit
MBS457251-04 10x 96 Tests

Human MHC Class I Polypeptide Related Sequence B (MICB) ELISA Kit

Sign In for Pricing
View Details
L1 Antibody, HRP conjugated
A43320-100UG 100 µg

L1 Antibody, HRP conjugated

Sign In for Pricing
View Details
EIF2S2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0666503 1.0 µg DNA

EIF2S2 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details