Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus A Non-structural glycoprotein 4 protein

This Virus A Non-structural glycoprotein 4 protein spans the amino acid sequence from region 52-175aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NCVP5 (NS28) (NSP4)

UniProt

Q9PYC8

Expression Region

52-175aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Rotavirus A (isolate RVA/Cow/United States/B223/1983/G10P8[11 ]) (RV-A)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEWEWGKNPYEPKEVTAAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SLC2A4 sgRNA gene knockout kit - Lentiviral human SLC2A4 sgRNA gene knockout kit (100)
GTR15390832 1 Vial

Lentiviral human SLC2A4 sgRNA gene knockout kit - Lentiviral human SLC2A4 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
CD361 Rabbit Polyclonal Antibody (Cy5.5)
orb1066163 100 µL

CD361 Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Cytomegalovirus, Pp65 Tegument Protein (UL83) (CMV) (Biotin)
MBS6261171-01 0.1 mL

Cytomegalovirus, Pp65 Tegument Protein (UL83) (CMV) (Biotin)

Sign In for Pricing
View Details
Cytomegalovirus, Pp65 Tegument Protein (UL83) (CMV) (Biotin)
MBS6261171-02 5x 0.1 mL

Cytomegalovirus, Pp65 Tegument Protein (UL83) (CMV) (Biotin)

Sign In for Pricing
View Details
LRRC41 antibody
70R-18311 50 μL

LRRC41 antibody

Sign In for Pricing
View Details
TRAIL, CT (TNF-Related Apoptosis Inducing Ligand, Apo2L, TL2, TNFSF10) (MaxLight 750) discontinued
T8175-03-ML750 100 µL

TRAIL, CT (TNF-Related Apoptosis Inducing Ligand, Apo2L, TL2, TNFSF10) (MaxLight 750) discontinued

Sign In for Pricing
View Details