Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria isaA protein

This Bacteria isaA protein spans the amino acid sequence from region 30-233aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunodominant staphylococcal antigen A

UniProt

P60157

Expression Region

30-233aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Staphylococcus aureus (strain MW2)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEVNVDQAHLVDLAHNHQDQLNAAPIKDGAYDIHFVKDGFQYNFTSNGTTWSWSYEAANGQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQSSNSNVEAVSAPTYHNYSTSTTSSSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAIIARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQINAAVKAYKAQGLGAWGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KMO Knockout A549 cell line
GTR15413427 1 Vial

Human KMO Knockout A549 cell line

Sign In for Pricing
View Details
Anti-OSCAR Antibody Picoband®
A02961-3-carrier-free 100 µg/Vial

Anti-OSCAR Antibody Picoband®

Sign In for Pricing
View Details
TCEA1P3 Protein Vector (Human) (pPM-C-His)
PV135009 500 ng

TCEA1P3 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
AdmiRa-hsa-miR-3677-3p-Off Virus
mh5643 1.0 mL

AdmiRa-hsa-miR-3677-3p-Off Virus

Sign In for Pricing
View Details
C2orf47 siRNA (Human)
MBS8216026-01 15 nmol

C2orf47 siRNA (Human)

Sign In for Pricing
View Details
C2orf47 siRNA (Human)
MBS8216026-02 30 nmol

C2orf47 siRNA (Human)

Sign In for Pricing
View Details