Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Haptoglobin protein

This Human Haptoglobin protein spans the amino acid sequence from region 19-406aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Zonulin

UniProt

P00738

Expression Region

19-406aa

Tag

Tag-Free

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VDSGNDVTDIADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNDKKQWINKAVGDKLPECEADDGCPKPPEIAHGYVEHSVRYQCKNYYKLRTEGDGVYTLNNEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE-Linked Polyclonal Antibody to Wilms Tumor Protein (WT1)
MBS2119023-01 0.1 mL

PE-Linked Polyclonal Antibody to Wilms Tumor Protein (WT1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Wilms Tumor Protein (WT1)
MBS2119023-02 0.2 mL

PE-Linked Polyclonal Antibody to Wilms Tumor Protein (WT1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Wilms Tumor Protein (WT1)
MBS2119023-03 0.5 mL

PE-Linked Polyclonal Antibody to Wilms Tumor Protein (WT1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Wilms Tumor Protein (WT1)
MBS2119023-04 1 mL

PE-Linked Polyclonal Antibody to Wilms Tumor Protein (WT1)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Wilms Tumor Protein (WT1)
MBS2119023-05 5 mL

PE-Linked Polyclonal Antibody to Wilms Tumor Protein (WT1)

Sign In for Pricing
View Details
PRUNE Antibody
MBS9416946-01 0.1 mL

PRUNE Antibody

Sign In for Pricing
View Details