Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine ATP5MG protein

This Bovine ATP5MG protein spans the amino acid sequence from region 2-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP synthase membrane subunit g (ATPase subunit g) (ATP5L)

UniProt

Q28852

Expression Region

2-103aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SENP6 Rabbit Polyclonal Antibody
TA371506 100 µL

SENP6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (LAMP3/2990R), CF405S conjugate, 0.1mg/mL
BNC042990-100 1x 100 µL

CD63 (Late Endosomes Marker) (LAMP3/2990R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Annexin V Recombinant Rabbit Monoclonal Antibody [JF50-11]
ET1702-62 100 µL

Annexin V Recombinant Rabbit Monoclonal Antibody [JF50-11]

Sign In for Pricing
View Details
ISG15 (N-term) Rabbit Polyclonal Antibody
AP11162PU-N 400 µL

ISG15 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOC220670 Human qPCR Primer Pair (XM_165981)
HP221141 200 Reactions

LOC220670 Human qPCR Primer Pair (XM_165981)

Sign In for Pricing
View Details
L-Pyroglutamic Acid-13C5
TRC-P997482-5MG 5 mg

L-Pyroglutamic Acid-13C5

Sign In for Pricing
View Details