Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine ATP5MG protein

This Bovine ATP5MG protein spans the amino acid sequence from region 2-103aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ATP synthase membrane subunit g (ATPase subunit g) (ATP5L)

UniProt

Q28852

Expression Region

2-103aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEFVRNLAEKAPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVATEVWMWFYVGEIIGKRGIIGYDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GCET1 (SERPINA9) (Center) Rabbit Polyclonal Antibody
AP53860PU-N 400 µL

GCET1 (SERPINA9) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Palladium On Carbon (extent of labeling: 10 wt. % loading, matrix carbon, dry support)
TRC-P141075-2.5G 2.5 g

Palladium On Carbon (extent of labeling: 10 wt. % loading, matrix carbon, dry support)

Sign In for Pricing
View Details
PHF11 (NM_001040444) Human Over-expression Lysate
LY421762 100 µg

PHF11 (NM_001040444) Human Over-expression Lysate

Sign In for Pricing
View Details
EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), 0.2mg/mL
BNUB2041-500 1x 500 µL

EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), 0.2mg/mL

Sign In for Pricing
View Details
ZBTB3 Polyclonal Antibody
E-AB-19552-01 20 µL

ZBTB3 Polyclonal Antibody

Sign In for Pricing
View Details
ZBTB3 Polyclonal Antibody
E-AB-19552-02 60 µL

ZBTB3 Polyclonal Antibody

Sign In for Pricing
View Details