Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GCGR protein

This Human GCGR protein spans the amino acid sequence from region 26-136aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GL-R

UniProt

P47871

Expression Region

26-136aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM41A Protein Vector (Rat) (pPB-N-His)
PV311715 500 ng

TMEM41A Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
S100A14 Rabbit Polyclonal Antibody (Fluoro488)
orb3102089 100 µg

S100A14 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Anti-Smad5 Rabbit Monoclonal Antibody
M01423-2-200μl 200 µL

Anti-Smad5 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
S1PR1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-Protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1, EDG1) (MaxLight 750)
MBS6247352-01 0.1 mL

S1PR1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-Protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1, EDG1) (MaxLight 750)

Sign In for Pricing
View Details
S1PR1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-Protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1, EDG1) (MaxLight 750)
MBS6247352-02 5x 0.1 mL

S1PR1 (Sphingosine 1-phosphate Receptor 1, S1P Receptor 1, S1P1, Endothelial Differentiation G-Protein Coupled Receptor 1, Sphingosine 1-phosphate Receptor Edg-1, S1P Receptor Edg-1, CD363, CHEDG1, EDG1) (MaxLight 750)

Sign In for Pricing
View Details
ANO1, ID (ANO1, DOG1, ORAOV2, TAOS2, TMEM16A, Anoctamin-1, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2) (MaxLight 550) discontinued
031910-ML550 100 µL

ANO1, ID (ANO1, DOG1, ORAOV2, TAOS2, TMEM16A, Anoctamin-1, Discovered on gastrointestinal stromal tumors protein 1, Oral cancer overexpressed protein 2, Transmembrane protein 16A, Tumor-amplified and overexpressed sequence 2) (MaxLight 550) discontinued

Sign In for Pricing
View Details