Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TEAD4 protein

This Human TEAD4 protein spans the amino acid sequence from region 74-434aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TEA domain family member 4 (TEAD-4) (Transcription factor 13-like 1) (Transcription factor RTEF-1) (RTEF1) (TCF13L1) (TEF3)

UniProt

Q15561

Expression Region

74-434aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human NKG2C&CD94 protein, C-His-Avi (HEK293)
orb2819920-01 20 µg

Recombinant human NKG2C&CD94 protein, C-His-Avi (HEK293)

Sign In for Pricing
View Details
Recombinant human NKG2C&CD94 protein, C-His-Avi (HEK293)
orb2819920-02 100 µg

Recombinant human NKG2C&CD94 protein, C-His-Avi (HEK293)

Sign In for Pricing
View Details
Recombinant human NKG2C&CD94 protein, C-His-Avi (HEK293)
orb2819920-03 500 µg

Recombinant human NKG2C&CD94 protein, C-His-Avi (HEK293)

Sign In for Pricing
View Details
NBEA (neurobeachin, BCL8B, LYST2) (AP) discontinued
249149-AP 100 µL

NBEA (neurobeachin, BCL8B, LYST2) (AP) discontinued

Sign In for Pricing
View Details
Methyl 9-chloro-9-oxononanoate
OR28883 1 Each

Methyl 9-chloro-9-oxononanoate

Sign In for Pricing
View Details
RAB30 Mouse Monoclonal Antibody [Clone ID: OTI4B10]
TA505342S 30 µL

RAB30 Mouse Monoclonal Antibody [Clone ID: OTI4B10]

Sign In for Pricing
View Details