Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TEAD4 protein

This Human TEAD4 protein spans the amino acid sequence from region 74-434aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TEA domain family member 4 (TEAD-4) (Transcription factor 13-like 1) (Transcription factor RTEF-1) (RTEF1) (TCF13L1) (TEF3)

UniProt

Q15561

Expression Region

74-434aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

67.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tomt ELISA Kit
ELI-17142r 96 Tests

Rat Tomt ELISA Kit

Sign In for Pricing
View Details
Rabbit anti-FYCOl Antibody, Affinity Purified
A302-796A-T 2 µg

Rabbit anti-FYCOl Antibody, Affinity Purified

Sign In for Pricing
View Details
CD59 (NM_203329) Human Untagged Clone
SC324423 10 µg

CD59 (NM_203329) Human Untagged Clone

Sign In for Pricing
View Details
H2N-PEG-SH (MW 3400)
HY-W1048545I 1 Each

H2N-PEG-SH (MW 3400)

Sign In for Pricing
View Details
Sickle cell S MB-Fl; 25 ug
45-6545-01 25 µg

Sickle cell S MB-Fl; 25 ug

Sign In for Pricing
View Details
Rabbit Polyclonal CLPX Antibody [PE]
NBP2-97804PE 0.1 mL

Rabbit Polyclonal CLPX Antibody [PE]

Sign In for Pricing
View Details