Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant BAM1 protein

This Plant BAM1 protein spans the amino acid sequence from region 42-354aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 7) (Thioredoxin-regulated beta-amylase) (TR-BAMY) (BMY7) (TRBAMY)

UniProt

Q9LIR6

Expression Region

42-354aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C14orf50 (PPP1R36) Mouse Monoclonal Antibody [Clone ID: OTI5F6]
CF809429 100 µg

C14orf50 (PPP1R36) Mouse Monoclonal Antibody [Clone ID: OTI5F6]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992UP-01 25 µg

PE/Elab Fluor® 594 Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992UP-02 100 µg

PE/Elab Fluor® 594 Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details
5X Tris Phosphate-EDTA (TPE), Ultra Pure Grade, 1L
PB1330-1L 1 L

5X Tris Phosphate-EDTA (TPE), Ultra Pure Grade, 1L

Sign In for Pricing
View Details
CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF568 conjugate, 0.1mg/mL
BNC682937-100 1x 100 µL

CD47 / IAP (Integrin Associated Protein) (CD47/2937), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details