Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant BAM1 protein

This Plant BAM1 protein spans the amino acid sequence from region 42-354aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 7) (Thioredoxin-regulated beta-amylase) (TR-BAMY) (BMY7) (TRBAMY)

UniProt

Q9LIR6

Expression Region

42-354aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sln Mouse Gene Knockout Kit (CRISPR)
KN516259 1 Kit

Sln Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MCL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9C9]
TA500987BM 100 µL

MCL1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9C9]

Sign In for Pricing
View Details
Keratinocyte differentiation associated protein (KRTDAP) (NM_207392) Human Over-expression Lysate
LY404003 100 µg

Keratinocyte differentiation associated protein (KRTDAP) (NM_207392) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant KAP1 Monoclonal Antibody
AN300993L-01 50 µL

Recombinant KAP1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant KAP1 Monoclonal Antibody
AN300993L-02 100 µL

Recombinant KAP1 Monoclonal Antibody

Sign In for Pricing
View Details
PAX8 Rabbit Polyclonal Antibody
TA379658 100 µL

PAX8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details