Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Plant BAM1 protein

This Plant BAM1 protein spans the amino acid sequence from region 42-354aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

1,4-alpha-D-glucan maltohydrolase (Beta-amylase 7) (Thioredoxin-regulated beta-amylase) (TR-BAMY) (BMY7) (TRBAMY)

UniProt

Q9LIR6

Expression Region

42-354aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Arabidopsis thaliana (Mouse-ear cress)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMNRNYKAHGTDPSPPMSPILGATRADLSVACKAFAVENGIGTIEEQRTYREGGIGGKKEGGGGVPVFVMMPLDSVTMGNTVNRRKAMKASLQALKSAGVEGIMIDVWWGLVEKESPGTYNWGGYNELLELAKKLGLKVQAVMSFHQCGGNVGDSVTIPLPQWVVEEVDKDPDLAYTDQWGRRNHEYISLGADTLPVLKGRTPVQCYADFMRAFRDNFKHLLGETIVEIQVGMGPAGELRYPSYPEQEGTWKFPGIGAFQCYDKYSLSSLKAAAETYGKPEWGSTGPTDAGHYNNWPEDTQFFKKEGGGWNSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Thyroid gland
CR560874 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
AHI1-DT Antibody
KC-36216-01 50 μL

AHI1-DT Antibody

Sign In for Pricing
View Details
AHI1-DT Antibody
KC-36216-02 100 µL

AHI1-DT Antibody

Sign In for Pricing
View Details
AHI1-DT Antibody
KC-36216-03 1 mL

AHI1-DT Antibody

Sign In for Pricing
View Details
Human CDC26 activation kit by CRISPRa
GA116721 1 Kit

Human CDC26 activation kit by CRISPRa

Sign In for Pricing
View Details
HIRA Mouse Monoclonal Antibody [Clone ID: 10]
AM05331PU-N 100 µg

HIRA Mouse Monoclonal Antibody [Clone ID: 10]

Sign In for Pricing
View Details