Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TFF3 protein

This Human TFF3 protein spans the amino acid sequence from region 29-80aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Intestinal trefoil factor (hITF) (Polypeptide P1.B) (hP1.B) (ITF) (TFI)

UniProt

Q07654

Expression Region

29-80aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACSM1 siRNA (Human)
CRJ4505-01 15 nmol

ACSM1 siRNA (Human)

Sign In for Pricing
View Details
ACSM1 siRNA (Human)
CRJ4505-02 30 nmol

ACSM1 siRNA (Human)

Sign In for Pricing
View Details
ST7 Protein Vector (Rat) (pPB-C-His)
PV308362 500 ng

ST7 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
Tissue Protein Lysate, Liver
LS781230 150 µg

Tissue Protein Lysate, Liver

Sign In for Pricing
View Details
Rabbit Anti-Human immunoglobulin G mAb
MA620-01 50 μL

Rabbit Anti-Human immunoglobulin G mAb

Sign In for Pricing
View Details
Rabbit Anti-Human immunoglobulin G mAb
MA620-02 100 μL

Rabbit Anti-Human immunoglobulin G mAb

Sign In for Pricing
View Details