Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria tfpQ protein

This Bacteria tfpQ protein spans the amino acid sequence from region 7-157aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta pilin (Q pilin)

UniProt

P07640

Expression Region

7-157aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Moraxella bovis

Field of Research

Epigenetics, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

FTLIELMIVIAIIGILAAIALPAYQDYISKSQTTRVVGELAAGKTAVDAALFEGKTPKLGKAANDTEEDIGLTTTGGTARSNLMSSVNIGGGAFATGAGTLEATLGNRANKDIAGAVITQSRDAEGVWTCTINGSAAPGWKSKFVPTGCKE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EFNB1 (Ephrin-B1, EPH-related Receptor Tyrosine Kinase Ligand 2, CFND, CFNS, EFL3, EPLG2, Elk-L, LERK2) (APC)
MBS6415123-01 0.1 mL

EFNB1 (Ephrin-B1, EPH-related Receptor Tyrosine Kinase Ligand 2, CFND, CFNS, EFL3, EPLG2, Elk-L, LERK2) (APC)

Sign In for Pricing
View Details
EFNB1 (Ephrin-B1, EPH-related Receptor Tyrosine Kinase Ligand 2, CFND, CFNS, EFL3, EPLG2, Elk-L, LERK2) (APC)
MBS6415123-02 5x 0.1 mL

EFNB1 (Ephrin-B1, EPH-related Receptor Tyrosine Kinase Ligand 2, CFND, CFNS, EFL3, EPLG2, Elk-L, LERK2) (APC)

Sign In for Pricing
View Details
Mouse Lmbr1 (NM_020295) AAV Particle
MR218036A1V 250 µL

Mouse Lmbr1 (NM_020295) AAV Particle

Sign In for Pricing
View Details
OTUB2 antibody
MBS833265-01 0.1 mL

OTUB2 antibody

Sign In for Pricing
View Details
OTUB2 antibody
MBS833265-02 5x 0.1 mL

OTUB2 antibody

Sign In for Pricing
View Details
Amadinone acetate
MBS5779570 Inquire

Amadinone acetate

Sign In for Pricing
View Details