Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria MAP_1030 protein

This Bacteria MAP_1030 protein spans the amino acid sequence from region 1-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAP_1030, Probable transcriptional regulatory protein MAP_1030

UniProt

P62039

Expression Region

1-250aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTITYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKSVVTCEKNGLTEDDILAAVLDAGAEEVEDLGDSFEIICEPTDLVAVRTALQDAGIDYDSAEAGFQPSVTVPLNADGAQKVMRLVDALEDSDDVQDVWTNADIPDEILAQIEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal MCRS1 Antibody
NBP2-85264-0.1mL 0.1 mL

Rabbit Polyclonal MCRS1 Antibody

Sign In for Pricing
View Details
MYCBP siRNA (Human)
CRH8811-01 15 nmol

MYCBP siRNA (Human)

Sign In for Pricing
View Details
MYCBP siRNA (Human)
CRH8811-02 30 nmol

MYCBP siRNA (Human)

Sign In for Pricing
View Details
4- (cyclooctylamino) -4-oxobutanoic acid
sc-289566 100 mg

4- (cyclooctylamino) -4-oxobutanoic acid

Sign In for Pricing
View Details
Rat Monoclonal IL6R Antibody (D7715A7) [Alexa Fluor 488]
NBP3-12010AF488 0.1 mL

Rat Monoclonal IL6R Antibody (D7715A7) [Alexa Fluor 488]

Sign In for Pricing
View Details
Anti-Phospho-TIS11B (S92) antibody
STJ90549 200 µl

Anti-Phospho-TIS11B (S92) antibody

Sign In for Pricing
View Details