Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bacteria MAP_1030 protein

This Bacteria MAP_1030 protein spans the amino acid sequence from region 1-250aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MAP_1030, Probable transcriptional regulatory protein MAP_1030

UniProt

P62039

Expression Region

1-250aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGHSKWATTKHKKAVIDARRGKMFARLIKNIEVAARVGGGDPAGNPTLYDAIQKAKKSSVPNENIERARKRGAGEEAGGADWQTITYEGYAPNGVAVLIECLTDNRNRAASEVRVAMTRNGGTMADPGSVSYLFSRKSVVTCEKNGLTEDDILAAVLDAGAEEVEDLGDSFEIICEPTDLVAVRTALQDAGIDYDSAEAGFQPSVTVPLNADGAQKVMRLVDALEDSDDVQDVWTNADIPDEILAQIEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human GNG3 sgRNA gene knockout kit - Lentiviral human GNG3 sgRNA gene knockout kit (25)
GTR15388284 1 Vial

Lentiviral human GNG3 sgRNA gene knockout kit - Lentiviral human GNG3 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse POLR2K siRNA
abx929216-01 15 nmol

Mouse POLR2K siRNA

Sign In for Pricing
View Details
Mouse POLR2K siRNA
abx929216-02 30 nmol

Mouse POLR2K siRNA

Sign In for Pricing
View Details
BTG4 CRISPRa sgRNA lentivector (set of three targets)(Human)
13557121 3x 1.0µg DNA

BTG4 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Nedd8 (NM_008683) Mouse Tagged ORF Clone
MG200148 10 µg

Nedd8 (NM_008683) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Mouse Interleukin 12 (IL12) CLIA Kit
abx195846 96 Tests

Mouse Interleukin 12 (IL12) CLIA Kit

Sign In for Pricing
View Details