Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PYY protein

This Human PYY protein spans the amino acid sequence from region 31-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PYY-I (PYY)

UniProt

P10082

Expression Region

31-64aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

6.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IKPEAPREDASPEELNRYYASLRHYLNLVTRQRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAX1BP1 Antibody, FITC conjugated
MBS7107369-01 0.05 mg

TAX1BP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
TAX1BP1 Antibody, FITC conjugated
MBS7107369-02 0.1 mg

TAX1BP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
TAX1BP1 Antibody, FITC conjugated
MBS7107369-03 5x 0.1 mg

TAX1BP1 Antibody, FITC conjugated

Sign In for Pricing
View Details
Anti-IRAK1 antibody
STJ114498 100 µl

Anti-IRAK1 antibody

Sign In for Pricing
View Details
Kctd11 AAV siRNA Pooled Vector
25440164 1.0 µg

Kctd11 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Ferret IgM Native Protein
117474 100 µg

Ferret IgM Native Protein

Sign In for Pricing
View Details