Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human APOB protein

This Human APOB protein spans the amino acid sequence from region 28-127aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apo B-100

UniProt

P04114

Expression Region

28-127aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEEMLENVSLVCPKDATRFKHLRKYTYNYEAESSSGVPGTADSRSATRINCKVELEVPQLCSFILKTSQCTLKEVYGFNPEGKALLKKTKNSEEFAAAMS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ARIH2 Antibody (OTI3F9) - Azide and BSA Free
NBP2-71600 100 µg

Mouse Monoclonal ARIH2 Antibody (OTI3F9) - Azide and BSA Free

Sign In for Pricing
View Details
Phytolaccagenic acid
TN2065 20 mg

Phytolaccagenic acid

Sign In for Pricing
View Details
Anti-CD5 antibody
MO5PP5.5-(V25) 25 µg

Anti-CD5 antibody

Sign In for Pricing
View Details
Krtap1-4 ORF Vector (Mouse) (pORF)
ORF048851 1.0 µg DNA

Krtap1-4 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-CD55/DAF Antibody (4F891)
TMAY-03307-01 20 µL

Anti-CD55/DAF Antibody (4F891)

Sign In for Pricing
View Details
Anti-CD55/DAF Antibody (4F891)
TMAY-03307-02 100 µL

Anti-CD55/DAF Antibody (4F891)

Sign In for Pricing
View Details