Porcine IL4R protein
This Porcine IL4R protein spans the amino acid sequence from region 33-240aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CD_antigen, CD124 (IL-4 receptor subunit alpha) (IL-4R subunit alpha) (IL-4R-alpha) (IL-4RA)
UniProt
Q863Z5
Expression Region
33-240aa
Tag
N-terminal 6xHis-tagged
Source
Yeast
Origin
Sus scrofa (Pig)
Field of Research
Cancer Biology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
26.2 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Extracellular Domain
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
VRVLEWPICLSDYVSTSTCEWRMAGPVNCSAEFRLSYQLKFFNTENHTTCVPENRAGSVCVCHMLMESIVIVDTYQLDLWAGEQLLWNSSFKPSQNVKPLAPRNLMVHANISHTWLLTWSNPYPSESYLYSELTYLVNISNENDPTDFRIYNVTYLGPTLRFPANTLKSGAAYSARVKAWAQRYNSTWSEWSPSVKWLNYYEEPLEQR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC051037-100 1x 100 µL
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470031-100 1x 100 µL
Mucin 5AC (MUC5AC) (45M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400631-100 1x 100 µL
Human Lambda Light Chain (LcN-2), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details