Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL1 alpha protein

This Human IL1 alpha protein spans the amino acid sequence from region 113-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hematopoietin-1 (IL-1 alpha) (IL1F1)

UniProt

P01583

Expression Region

113-271aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM29 (Lung Squamous Cell Carcinoma Marker) Antibody
orb1712065 0.5 mL

TRIM29 (Lung Squamous Cell Carcinoma Marker) Antibody

Sign In for Pricing
View Details
CP 461
orb1697727-01 1 mg

CP 461

Sign In for Pricing
View Details
CP 461
orb1697727-02 5 mg

CP 461

Sign In for Pricing
View Details
CP 461
orb1697727-03 10 mg

CP 461

Sign In for Pricing
View Details
CP 461
orb1697727-04 25 mg

CP 461

Sign In for Pricing
View Details
CP 461
orb1697727-05 50 mg

CP 461

Sign In for Pricing
View Details