Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus CYS4 protein

This Virus CYS4 protein spans the amino acid sequence from region 1-345aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-thionase (Serine sulfhydrase) (Sulfur transfer protein 4) (STR4)

UniProt

P32582

Expression Region

1-345aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKSEQQADSRHNVIDLVGNTPLIALKKLPKALGIKPQIYAKLELYNPGGSIKDRIAKSMVEEAEASGRIHPSRSTLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHIGVAKKLEKEIPGAVILDQYNNMMNPEAHYFGTGREIQRQLEDLNLFDNLRAVVAGAGTGGTISGISKYLKEQNDKIQIVGADPFGSILAQPENLNKTDITDYKVEGIGYDFVPQVLDRKLIDVWYKTDDKPSFKYARQLISNEGVLVGGSSGSAFTAVVKYCEDHPELTEDDVIVAIFPDSIRSYLTKFVDDEWLKKNNLWDDDVL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOAT1 Peptide - middle region
orb2008912 100 µg

SOAT1 Peptide - middle region

Sign In for Pricing
View Details
TTC19 Recombinant Protein (Human)
RP033280 100 µg

TTC19 Recombinant Protein (Human)

Sign In for Pricing
View Details
Ribosomal Protein S12 Polyclonal Antibody
RA29438-01 50 µL

Ribosomal Protein S12 Polyclonal Antibody

Sign In for Pricing
View Details
Ribosomal Protein S12 Polyclonal Antibody
RA29438-02 100 µL

Ribosomal Protein S12 Polyclonal Antibody

Sign In for Pricing
View Details
FBXL2 Antibody
CSB-PA892134LA01HU-01 50 µg

FBXL2 Antibody

Sign In for Pricing
View Details
FBXL2 Antibody
CSB-PA892134LA01HU-02 100 µg

FBXL2 Antibody

Sign In for Pricing
View Details