Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF-A, Pig (His)

The VEGF-A protein is a multifunctional growth factor that is essential for promoting angiogenesis, vasculogenesis, and endothelial cell growth. Its multiple effects include inducing endothelial cell proliferation, promoting migration, inhibiting apoptosis, and increasing vascular permeability. VEGF-A Protein, Pig (His) is the recombinant pig-derived VEGF-A protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

VEGF-A Protein, Pig (His), Pig, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vascular-endothelial-growth-factor-a-vegfa-pig--his.html

Purity

92.00

Smiles

APMAEGDQKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

397157 (Gene_ID) P49151 (A27-R190) (Accession)

Molecular Weight

Approximately 23 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-PDE2A Polyclonal Antibody
PAV2982 100 μL

Rabbit Anti-PDE2A Polyclonal Antibody

Sign In for Pricing
View Details
SV2C Polyclonal Antibody, Cy5 Conjugated
bs-11366R-Cy5 100 µL

SV2C Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
ZEB2 Blocking Peptide
CBP3374-01 1 mg

ZEB2 Blocking Peptide

Sign In for Pricing
View Details
ZEB2 Blocking Peptide
CBP3374-02 5 mg

ZEB2 Blocking Peptide

Sign In for Pricing
View Details
EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (Biotin)
MBS6141746-01 0.1 mL

EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (Biotin)

Sign In for Pricing
View Details
EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (Biotin)
MBS6141746-02 5x 0.1 mL

EPDR1 (Ependymin Related Protein 1, EPDR, Mammalian Ependymin Related Protein 1, MERP1, MERP-1, Upregulated in Colorectal Cancer Gene 1, UCC1) (Biotin)

Sign In for Pricing
View Details