Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli insE1 protein

This E. coli insE1 protein spans the amino acid sequence from region 1-99aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

InsE1, b0298, JW5036, Transposase InsE for insertion sequence IS3A

UniProt

P0CF66

Expression Region

1-99aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Urinary Trypsin Inhibitor Fragment
H-2692.0005 5.0mg

Urinary Trypsin Inhibitor Fragment

Sign In for Pricing
View Details
BIVM sgRNA CRISPR Lentivector (Human) (Target 3)
K0184804 1.0 µg DNA

BIVM sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Specnuezhenide 100mg
A14695-100 100 mg

Specnuezhenide 100mg

Sign In for Pricing
View Details
CDH11, CT (CDH11, Cadherin-11, OSF-4, Osteoblast cadherin) (Azide free) (HRP) discontinued
033621-HRP 200 µL

CDH11, CT (CDH11, Cadherin-11, OSF-4, Osteoblast cadherin) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
PDE7A (B-11) Alexa Fluor® 546
sc-398031 AF546 200 µg/mL

PDE7A (B-11) Alexa Fluor® 546

Sign In for Pricing
View Details
Rat GATA Binding Protein 6 (GATA6) ELISA Kit
YP-W31908-01 48 Tests

Rat GATA Binding Protein 6 (GATA6) ELISA Kit

Sign In for Pricing
View Details