Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli insE1 protein

This E. coli insE1 protein spans the amino acid sequence from region 1-99aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

InsE1, b0298, JW5036, Transposase InsE for insertion sequence IS3A

UniProt

P0CF66

Expression Region

1-99aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KIR2DL1/CD158a Antibody (MM0438-11G25) [mFluor Violet 450 SE]
NBP2-11758MFV450 0.1 mL

Mouse Monoclonal KIR2DL1/CD158a Antibody (MM0438-11G25) [mFluor Violet 450 SE]

Sign In for Pricing
View Details
Rabbit Polyclonal EIF3B Antibody [Alexa Fluor 647]
NBP2-97742AF647 0.1 mL

Rabbit Polyclonal EIF3B Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Anti-ADRA1A Rabbit Monoclonal Antibody
B2020923 100 µL

Anti-ADRA1A Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FOXM1 (Forkhead Box M1, FKHL16, FOXM1B, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TGT3, TRIDENT) (Biotin)
246298-Biotin 100 µL

FOXM1 (Forkhead Box M1, FKHL16, FOXM1B, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TGT3, TRIDENT) (Biotin)

Sign In for Pricing
View Details
Anti-Activin A Receptor Type IB Rabbit Monoclonal Antibody
MA1076-.1 100 µL

Anti-Activin A Receptor Type IB Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1) Antibody (Biotin)
abx106046-01 20 µg

Ubiquitin Carboxyl Terminal Hydrolase L1 (UCHL1) Antibody (Biotin)

Sign In for Pricing
View Details