Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli insE1 protein

This E. coli insE1 protein spans the amino acid sequence from region 1-99aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

InsE1, b0298, JW5036, Transposase InsE for insertion sequence IS3A

UniProt

P0CF66

Expression Region

1-99aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF24 3'UTR Luciferase Stable Cell Line
TU028931 1.0 mL

ZNF24 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Sample release reagent
HMD3504-02 8 mL

Sample release reagent

Sign In for Pricing
View Details
Rabbit Polyclonal TINP1 Antibody [Alexa Fluor 532]
NBP2-99405AF532 0.1 mL

Rabbit Polyclonal TINP1 Antibody [Alexa Fluor 532]

Sign In for Pricing
View Details
MIP1A, Recombinant, Human, Western Blot Control (C-C Motif Chemokine 3, G0/G1 Switch Regulatory Protein 19-1, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein, CCL3, G0S19-1, SCYA3) discontinued
M1202-09K 10 µg

MIP1A, Recombinant, Human, Western Blot Control (C-C Motif Chemokine 3, G0/G1 Switch Regulatory Protein 19-1, Macrophage Inflammatory Protein 1-alpha, MIP-1-alpha, PAT 464.1, SIS-beta, Small-inducible Cytokine A3, Tonsillar Lymphocyte LD78 alpha Protein, CCL3, G0S19-1, SCYA3) discontinued

Sign In for Pricing
View Details
Anti-Human CD84 Antibody (SAA0037), PerCP
HV297147-01 1 Each

Anti-Human CD84 Antibody (SAA0037), PerCP

Sign In for Pricing
View Details
Anti-Human CD84 Antibody (SAA0037), PerCP
HV297147-02 100 Tests

Anti-Human CD84 Antibody (SAA0037), PerCP

Sign In for Pricing
View Details