Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Canine BGLAP protein

This Canine BGLAP protein spans the amino acid sequence from region 1-49aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bone Gla protein (BGP) (Gamma-carboxyglutamic acid-containing protein)

UniProt

P81455

Expression Region

1-49aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Mycobacterium tuberculosis Cholesterol oxidase polyclonal Antibody
MBS1490588-01 0.05 mg

Rabbit anti-Mycobacterium tuberculosis Cholesterol oxidase polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Mycobacterium tuberculosis Cholesterol oxidase polyclonal Antibody
MBS1490588-02 0.1 mg

Rabbit anti-Mycobacterium tuberculosis Cholesterol oxidase polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-Mycobacterium tuberculosis Cholesterol oxidase polyclonal Antibody
MBS1490588-03 5x 0.1 mg

Rabbit anti-Mycobacterium tuberculosis Cholesterol oxidase polyclonal Antibody

Sign In for Pricing
View Details
FIZ1 Protein Vector (Mouse) (pPM-C-His)
PV179593 500 ng

FIZ1 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Claudin 3 (CLDN3)
TRV-0024578-01 100 µL

Biotin-Linked Polyclonal Antibody to Claudin 3 (CLDN3)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Claudin 3 (CLDN3)
TRV-0024578-02 200 µL

Biotin-Linked Polyclonal Antibody to Claudin 3 (CLDN3)

Sign In for Pricing
View Details