Canine BGLAP protein
This Canine BGLAP protein spans the amino acid sequence from region 1-49aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Bone Gla protein (BGP) (Gamma-carboxyglutamic acid-containing protein)
UniProt
P81455
Expression Region
1-49aa
Tag
N-terminal 6xHis-KSI-tagged
Source
E.coli
Origin
Canis lupus familiaris (Dog) (Canis familiaris)
Field of Research
Signal Transduction
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
YLDSGLGAPVPYPDPLEPKREVCELNPNCDELADHIGFQEAYQRFYGPV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS9334626-01 48 Well
Mouse Leucine-rich repeat and WD repeat-containing protein 1, LRWD1 ELISA Kit
Sign In for Pricing
View Details MBS9334626-02 96 Well
Mouse Leucine-rich repeat and WD repeat-containing protein 1, LRWD1 ELISA Kit
Sign In for Pricing
View Details MBS9334626-03 5x 96 Well
Mouse Leucine-rich repeat and WD repeat-containing protein 1, LRWD1 ELISA Kit
Sign In for Pricing
View Details MBS9334626-04 10x 96 Well
Mouse Leucine-rich repeat and WD repeat-containing protein 1, LRWD1 ELISA Kit
Sign In for Pricing
View Details 