Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OARD1 protein

This Human OARD1 protein spans the amino acid sequence from region 2-152aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

O-acetyl-ADP-ribose deacetylase 1 (EC, 3.5.1.-) (Terminal ADP-ribose protein glycohydrolase 1) ([Protein ADP-ribosylglutamate] hydrolase OARD1) (C6orf130) (TARG1)

UniProt

Q9Y530

Expression Region

2-152aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASSLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKKFGGVQELLNQQKKSGEVAVLKRDGRYIYYLITKKRASHKPTYENLQKSLEAMKSHCLKNGVTDLSMPRIGCGLDRLQWENVSAMIEEVFEATDIKITVYTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rno-miR-342-5p miRNA Inhibitor
MBS8297533-01 10 nmol

rno-miR-342-5p miRNA Inhibitor

Sign In for Pricing
View Details
rno-miR-342-5p miRNA Inhibitor
MBS8297533-02 20 nmol

rno-miR-342-5p miRNA Inhibitor

Sign In for Pricing
View Details
rno-miR-342-5p miRNA Inhibitor
MBS8297533-03 5x 20 nmol

rno-miR-342-5p miRNA Inhibitor

Sign In for Pricing
View Details
Human FGFBP2 (Fibroblast Growth Factor Binding Protein 2) ELISA Kit
RE3017H-01 48 Tests

Human FGFBP2 (Fibroblast Growth Factor Binding Protein 2) ELISA Kit

Sign In for Pricing
View Details
Human FGFBP2 (Fibroblast Growth Factor Binding Protein 2) ELISA Kit
RE3017H-02 96 Tests

Human FGFBP2 (Fibroblast Growth Factor Binding Protein 2) ELISA Kit

Sign In for Pricing
View Details
CF®660R Tyramide
#92195 1x 500 µg

CF®660R Tyramide

Sign In for Pricing
View Details