Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus GSP1 protein

This Virus GSP1 protein spans the amino acid sequence from region 2-219aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chromosome stability protein 17 (GTPase Ran homolog) (Genetic suppressor of PRP20-1) (CNR1) (CST17)

UniProt

P32835

Expression Region

2-219aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCA2A Antibody
orb1255566 100 µL

GUCA2A Antibody

Sign In for Pricing
View Details
Synaptotagmin 17 (SYT17) Antibody
abx145899-01 100 µg

Synaptotagmin 17 (SYT17) Antibody

Sign In for Pricing
View Details
Synaptotagmin 17 (SYT17) Antibody
abx145899-02 1 mg

Synaptotagmin 17 (SYT17) Antibody

Sign In for Pricing
View Details
Fast Blue BB salt
GT5977-10g 10 g

Fast Blue BB salt

Sign In for Pricing
View Details
CCT365623
HY-124674 1 Each

CCT365623

Sign In for Pricing
View Details
Custom RNA oligo 5 umol scale
27-6400-06 1 Each

Custom RNA oligo 5 umol scale

Sign In for Pricing
View Details