Virus GSP1 protein
This Virus GSP1 protein spans the amino acid sequence from region 2-219aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Chromosome stability protein 17 (GTPase Ran homolog) (Genetic suppressor of PRP20-1) (CNR1) (CST17)
UniProt
P32835
Expression Region
2-219aa
Tag
N-terminal 10xHis-tagged
Source
E.coli
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Field of Research
Infectious Disease & Virology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
30.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIGVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAGNPQLEFVASPALAPPEVQVDEQLMQQYQQEMEQATALPLPDEDDADL
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
53662141 1x 10^6 Cells / 1.0 mL
C17orf76 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details 
MBS6321589-01 0.1 mL
MOBKL3, NT (MOB4, MOB3, MOBKL3, PHOCN, PREI3, MOB-like protein phocein, 2C4D, Class II mMOB1, Mob1 homolog 3, Mps one binder kinase activator-like 3, Preimplantation protein 3) (MaxLight 650)
Sign In for Pricing
View Details MBS6321589-02 5x 0.1 mL
MOBKL3, NT (MOB4, MOB3, MOBKL3, PHOCN, PREI3, MOB-like protein phocein, 2C4D, Class II mMOB1, Mob1 homolog 3, Mps one binder kinase activator-like 3, Preimplantation protein 3) (MaxLight 650)
Sign In for Pricing
View Details