Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Kcp protein

This Mouse Kcp protein spans the amino acid sequence from region 1085-1425aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich BMP regulator 2 (Cysteine-rich motor neuron 2 protein) (CRIM-2) (Kielin/chordin-like protein 1) (KCP-1) (Crim2) (Kcp1)

UniProt

Q3U492

Expression Region

1085-1425aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QALSNCTEDLVGSELVPPDPCYTCQCQDLTWLCTHRACPELSCPLWERHTTPGSCCPVCKDPTQSCMHQGRWVASGEQWAVDACTSCSCVAGTVHCQTQRCRKLACSRDEVPALSPGSCCLRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHGEDFSVHVTNDDRGRRGVAWTQEVAVLLGTVAVRLLQGRTVMVDQHTVTLPFLREPLLYIELRGHTVILHAQPGLQVLWDGQSQVEVRVPSSYRGQTCGLCGNFNGFAQDDLQGPDGRLLPTEASFGNSWKVPKGLGPGRPCSAGREVDPCRAAGYRARREANARCGILKTSPFSHCHAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Paraoxonase 1 (PON1) ELISA Kit
RD-PON1-Ra-96Tests 96 Tests

Rat Paraoxonase 1 (PON1) ELISA Kit

Sign In for Pricing
View Details
Was (NM_009515) Mouse Tagged ORF Clone Lentiviral Particle
MR226777L3V 200 µL

Was (NM_009515) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SHMT1 Antibody (ARP49041_P050)
ARP49041_P050 100 µL

SHMT1 Antibody (ARP49041_P050)

Sign In for Pricing
View Details
Human major histocompatibility complex I , MHC I /HLA I ELISA Kit
NB-E11511-01 96 Well

Human major histocompatibility complex I , MHC I /HLA I ELISA Kit

Sign In for Pricing
View Details
Human major histocompatibility complex I , MHC I /HLA I ELISA Kit
NB-E11511-02 96 Well

Human major histocompatibility complex I , MHC I /HLA I ELISA Kit

Sign In for Pricing
View Details
Rat EIF2B3 siRNA
abx915143-01 15 nmol

Rat EIF2B3 siRNA

Sign In for Pricing
View Details