Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Kcp protein

This Mouse Kcp protein spans the amino acid sequence from region 1085-1425aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich BMP regulator 2 (Cysteine-rich motor neuron 2 protein) (CRIM-2) (Kielin/chordin-like protein 1) (KCP-1) (Crim2) (Kcp1)

UniProt

Q3U492

Expression Region

1085-1425aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QALSNCTEDLVGSELVPPDPCYTCQCQDLTWLCTHRACPELSCPLWERHTTPGSCCPVCKDPTQSCMHQGRWVASGEQWAVDACTSCSCVAGTVHCQTQRCRKLACSRDEVPALSPGSCCLRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHGEDFSVHVTNDDRGRRGVAWTQEVAVLLGTVAVRLLQGRTVMVDQHTVTLPFLREPLLYIELRGHTVILHAQPGLQVLWDGQSQVEVRVPSSYRGQTCGLCGNFNGFAQDDLQGPDGRLLPTEASFGNSWKVPKGLGPGRPCSAGREVDPCRAAGYRARREANARCGILKTSPFSHCHAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cyclin T1,CCNT1 ELISA KIT
JOT-EK2283Hu-01 96 Well

Human Cyclin T1,CCNT1 ELISA KIT

Sign In for Pricing
View Details
Human Cyclin T1,CCNT1 ELISA KIT
JOT-EK2283Hu-02 48 Well

Human Cyclin T1,CCNT1 ELISA KIT

Sign In for Pricing
View Details
Cggbp1 (NM_178647) Mouse Tagged Lenti ORF Clone
MR201375L4 10 µg

Cggbp1 (NM_178647) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
APG4B Polyclonal Antibody, FITC Conjugated
bs-1384R-FITC 100 µL

APG4B Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
PHF16 (JADE3) Human Over-expression Lysate
orb1341493 100 µg

PHF16 (JADE3) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human CD14 (C-6His)
C308-50ug 50 µg

Recombinant Human CD14 (C-6His)

Sign In for Pricing
View Details