Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Kcp protein

This Mouse Kcp protein spans the amino acid sequence from region 1085-1425aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich BMP regulator 2 (Cysteine-rich motor neuron 2 protein) (CRIM-2) (Kielin/chordin-like protein 1) (KCP-1) (Crim2) (Kcp1)

UniProt

Q3U492

Expression Region

1085-1425aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QALSNCTEDLVGSELVPPDPCYTCQCQDLTWLCTHRACPELSCPLWERHTTPGSCCPVCKDPTQSCMHQGRWVASGEQWAVDACTSCSCVAGTVHCQTQRCRKLACSRDEVPALSPGSCCLRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHGEDFSVHVTNDDRGRRGVAWTQEVAVLLGTVAVRLLQGRTVMVDQHTVTLPFLREPLLYIELRGHTVILHAQPGLQVLWDGQSQVEVRVPSSYRGQTCGLCGNFNGFAQDDLQGPDGRLLPTEASFGNSWKVPKGLGPGRPCSAGREVDPCRAAGYRARREANARCGILKTSPFSHCHAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAIAP1, CT (MAGI1, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 1, BAI1-associated Protein 1, BAP-1, Membrane-associated Guanylate Kinase Inverted 1, MAGI-1, Atrophin-1-interacting Protein 3, AIP-3, WW Domain-containing Prote
MBS624247-01 0.2 mL

BAIAP1, CT (MAGI1, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 1, BAI1-associated Protein 1, BAP-1, Membrane-associated Guanylate Kinase Inverted 1, MAGI-1, Atrophin-1-interacting Protein 3, AIP-3, WW Domain-containing Prote

Sign In for Pricing
View Details
BAIAP1, CT (MAGI1, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 1, BAI1-associated Protein 1, BAP-1, Membrane-associated Guanylate Kinase Inverted 1, MAGI-1, Atrophin-1-interacting Protein 3, AIP-3, WW Domain-containing Prote
MBS624247-02 5x 0.2 mL

BAIAP1, CT (MAGI1, Membrane-associated Guanylate Kinase, WW and PDZ Domain-containing Protein 1, BAI1-associated Protein 1, BAP-1, Membrane-associated Guanylate Kinase Inverted 1, MAGI-1, Atrophin-1-interacting Protein 3, AIP-3, WW Domain-containing Prote

Sign In for Pricing
View Details
Oleaside A
MBS3617780-01 2 mg

Oleaside A

Sign In for Pricing
View Details
Oleaside A
MBS3617780-02 5 mg

Oleaside A

Sign In for Pricing
View Details
Oleaside A
MBS3617780-03 10 mg

Oleaside A

Sign In for Pricing
View Details
Oleaside A
MBS3617780-04 25 mg

Oleaside A

Sign In for Pricing
View Details