Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine CSN2 protein

This Bovine CSN2 protein spans the amino acid sequence from region 16-224aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CSN2Beta-casein [Cleaved into, Casoparan, Antioxidant peptide, Casohypotensin]

UniProt

P02666

Expression Region

16-224aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPM1B Antibody
orb1323182 100 µL

PPM1B Antibody

Sign In for Pricing
View Details
Recombinant Mouse SIGLEC15/CD33L3 Protein, C-Fc
orb3154358-01 50 µg

Recombinant Mouse SIGLEC15/CD33L3 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Mouse SIGLEC15/CD33L3 Protein, C-Fc
orb3154358-02 100 µg

Recombinant Mouse SIGLEC15/CD33L3 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Mouse SIGLEC15/CD33L3 Protein, C-Fc
orb3154358-03 1 mg

Recombinant Mouse SIGLEC15/CD33L3 Protein, C-Fc

Sign In for Pricing
View Details
NUGGC (Nuclear GTPase SLIP-GC, 361-, Speckled-like pattern in the Germinal center, NUGGC, C8orf80) (MaxLight 490)
MBS6457818-01 0.1 mL

NUGGC (Nuclear GTPase SLIP-GC, 361-, Speckled-like pattern in the Germinal center, NUGGC, C8orf80) (MaxLight 490)

Sign In for Pricing
View Details
NUGGC (Nuclear GTPase SLIP-GC, 361-, Speckled-like pattern in the Germinal center, NUGGC, C8orf80) (MaxLight 490)
MBS6457818-02 5x 0.1 mL

NUGGC (Nuclear GTPase SLIP-GC, 361-, Speckled-like pattern in the Germinal center, NUGGC, C8orf80) (MaxLight 490)

Sign In for Pricing
View Details