Bovine CSN2 protein
This Bovine CSN2 protein spans the amino acid sequence from region 16-224aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
CSN2Beta-casein [Cleaved into, Casoparan, Antioxidant peptide, Casohypotensin]
UniProt
P02666
Expression Region
16-224aa
Tag
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Source
E.coli
Origin
Bos taurus (Bovine)
Field of Research
Signal Transduction
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
28.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Full Length of Mature Protein
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RRD04416-01 50 mg
Trans-3- (1, 1-Dioxido-2-isothiazolidinyl) -cyclobutanamine
Sign In for Pricing
View Details RRD04416-02 0.5 g
Trans-3- (1, 1-Dioxido-2-isothiazolidinyl) -cyclobutanamine
Sign In for Pricing
View Details 
MBS6191453-01 0.1 mL
NKX2-3 (Homeobox Protein Nkx-2.3, Homeobox Protein NK-2 Homolog C, NKX23, NKX2C) (MaxLight 405)
Sign In for Pricing
View Details MBS6191453-02 5x 0.1 mL
NKX2-3 (Homeobox Protein Nkx-2.3, Homeobox Protein NK-2 Homolog C, NKX23, NKX2C) (MaxLight 405)
Sign In for Pricing
View Details JOT-EK3923Hu-01 48 Well
Human Cluster of differentiation 2,CD2 ELISA KIT
Sign In for Pricing
View Details