Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H3A protein

This Human HIST1H3A protein spans the amino acid sequence from region 2-135aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3/a (Histone H3/b) (Histone H3/c) (Histone H3/d) (Histone H3/f) (Histone H3/h) (Histone H3/i) (Histone H3/j) (Histone H3/k) (Histone H3/l) (H3FAAND)

UniProt

P68431

Expression Region

2-135aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ribonuclease P protein subunit p38 (RPP38) Human ELISA Kit
G7873 96 Tests

Ribonuclease P protein subunit p38 (RPP38) Human ELISA Kit

Sign In for Pricing
View Details
HIVEP2 Protein Vector (Rat) (pPM-C-His)
PV272909 500 ng

HIVEP2 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
Porcine Keratan sulfate,KS ELISA Kit
CELI-66087p 96 Tests

Porcine Keratan sulfate,KS ELISA Kit

Sign In for Pricing
View Details
Rat Nucleobindin 1 (NUCB1) ELISA Kit
DLR-NUCB1-Ra-96T 96 Tests

Rat Nucleobindin 1 (NUCB1) ELISA Kit

Sign In for Pricing
View Details
NAP1L5 Human Gene Knockout Kit (CRISPR)
KN411191 1 Kit

NAP1L5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyp2c70 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
17392064 1.0 µg DNA

Cyp2c70 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details