Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H3A protein

This Human HIST1H3A protein spans the amino acid sequence from region 2-135aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3/a (Histone H3/b) (Histone H3/c) (Histone H3/d) (Histone H3/f) (Histone H3/h) (Histone H3/i) (Histone H3/j) (Histone H3/k) (Histone H3/l) (H3FAAND)

UniProt

P68431

Expression Region

2-135aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H1FOO, ID (H1FOO, H1OO, OSH1, Histone H1oo, Oocyte-specific histone H1, Oocyte-specific linker histone H1) (Azide free) (HRP)
MBS6305200-01 0.2 mL

H1FOO, ID (H1FOO, H1OO, OSH1, Histone H1oo, Oocyte-specific histone H1, Oocyte-specific linker histone H1) (Azide free) (HRP)

Sign In for Pricing
View Details
H1FOO, ID (H1FOO, H1OO, OSH1, Histone H1oo, Oocyte-specific histone H1, Oocyte-specific linker histone H1) (Azide free) (HRP)
MBS6305200-02 5x 0.2 mL

H1FOO, ID (H1FOO, H1OO, OSH1, Histone H1oo, Oocyte-specific histone H1, Oocyte-specific linker histone H1) (Azide free) (HRP)

Sign In for Pricing
View Details
CSDC2 siRNA (Mouse)
MBS8218581-01 15 nmol

CSDC2 siRNA (Mouse)

Sign In for Pricing
View Details
CSDC2 siRNA (Mouse)
MBS8218581-02 30 nmol

CSDC2 siRNA (Mouse)

Sign In for Pricing
View Details
CSDC2 siRNA (Mouse)
MBS8218581-03 5x 30 nmol

CSDC2 siRNA (Mouse)

Sign In for Pricing
View Details
6230427J02RIK Adenovirus (Mouse)
10825054 1.0 mL

6230427J02RIK Adenovirus (Mouse)

Sign In for Pricing
View Details