Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Chid1 protein

This Mouse Chid1 protein spans the amino acid sequence from region 20-393aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chid1Chitinase domain-containing protein 1

UniProt

Q922Q9

Expression Region

20-393aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TLSKSDAKKAASKMLLEKTQFSDKPVQDRGLVVTDIKAEDVVLEHRSYCSSRARERNFAGEVLGYVTPWNSHGYDVAKVFGSKFTQISPVWLQLKRRGREMFEITGLHDVDQGWMRAVKKHAKGVRIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVAQVAKNQHFDGFVVEVWSQLLSQKHVGLIHMLTHLAEALHQARLLVILVIPPAVTPGTDQLGMFTHKEFEQLAPILDGFSLMTYDYSTSQQPGPNAPLSWIRACVQVLDPKSQWRSKILLGLNFYGMDYAASKDAREPVIGARYVQTLKDHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQGLDYFYDLL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Plasmodium vivax MSP Recombinant Protein
orb1230292 0.01 mg

Plasmodium vivax MSP Recombinant Protein

Sign In for Pricing
View Details
SFRS8 Rabbit Polyclonal Antibody (PE-Cy5)
orb930834 100 µL

SFRS8 Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
Fibroblast Growth Factor 20 (FGF20) Mouse ELISA Kit
D4330 96 Tests

Fibroblast Growth Factor 20 (FGF20) Mouse ELISA Kit

Sign In for Pricing
View Details
Mouse Tsen2 qPCR Primer Pair
QM72978S 200 Tests

Mouse Tsen2 qPCR Primer Pair

Sign In for Pricing
View Details
Prednisolone 21-Dimethylamine-d6
462939 1 mg

Prednisolone 21-Dimethylamine-d6

Sign In for Pricing
View Details
PDZD8 Knockout jurkat Polyclonal Cells
ARG13050 1 Million

PDZD8 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details